PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa16g046300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 527aa    MW: 60795.9 Da    PI: 10.1148
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa16g046300.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B346.75.6e-15692196
                    EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3  1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95
                    ffk l     ++++ l++p  f+ ++ +g  e++kt +l++  s   W+vkl  ++++    lt+GWkeF+ a++L+ gD+v+F+ +  ++  ++v+
  Csa16g046300.1  6 FFKPL--LPGFQRH-LTIPVAFFVKYiKGRDEQKKTAKLRSdASKIIWNVKL--DGQR----LTDGWKEFALAHDLRIGDIVIFRQE--RDLAFHVT 91
                    67777..6678888.************77778999*****9677799*****..9888....***********************44..45545776 PP

                    E CS
              B3 96 v 96
                    +
  Csa16g046300.1 92 L 92
                    6 PP

2B372.74.7e-23132219493
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..E CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelv 93 
                     + + +++l+ + l +pk f++e+g ++ +s +++l++e+grsW++k++ + + g++++++GW +F++angLk+gD+v+Fk+++r  ++  v
  Csa16g046300.1 132 ANVAPSSLRYDSLLFPKAFVRENGVVT-GSGEIVLMNEKGRSWTLKMKQKPSCGTIYIRGGWINFCHANGLKSGDTVTFKMIQRrGTR--V 219
                     567889999999***********9885.666****************99999999*************************99873333..3 PP

3B365.21e-20277364492
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                     + + +++l+ + ++lp kf++e+g+ ++++ +++l++++grsW++ l+ ++  g++++++GWk F++angL +g +v+Fkl++++++ l
  Csa16g046300.1 277 ASIAPSSLRYDTMYLPIKFMRENGIYTKRG-EMILMNQKGRSWTLDLRRKNWCGTFFIKRGWKIFCRANGLSAGSIVTFKLIKKRGTLL 364
                     5678899999*************8876665.9***************98888999**************************98554434 PP

4B359.55.9e-19430526198
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy.rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                     f++ ++++++ + + l+lp++f++ ++++ke+  ++tl d++g++W+ kl   + ks+r  + +GWk+F +an +k++++++++l++++++ +v+
  Csa16g046300.1 430 FVTLTLTPYNVSASVLRLPRPFTRMNDIDKET--KMTLLDKQGKKWSTKLHLeDDKSKRLRMVGGWKGFLQANCVKANESIMLELIWEEDTICVL 522
                     667778999999999***********999655..8***************778999999****************************88886666 PP

                     EEE- CS
              B3  95 kvfr 98 
                     k+++
  Csa16g046300.1 523 KFRS 526
                     6665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.3E-233109IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.29E-17398IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.307396IPR003340B3 DNA binding domain
CDDcd100171.40E-13493No hitNo description
SMARTSM010199.7E-20696IPR003340B3 DNA binding domain
PfamPF023626.1E-101489IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.109.4E-21124221IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.34E-20127228IPR015300DNA-binding pseudobarrel domain
CDDcd100176.59E-21129224No hitNo description
PROSITE profilePS5086316.144129226IPR003340B3 DNA binding domain
SMARTSM010193.5E-26130226IPR003340B3 DNA binding domain
PfamPF023623.3E-21131220IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.7E-21267360IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.9E-19271367IPR015300DNA-binding pseudobarrel domain
CDDcd100171.03E-19274363No hitNo description
PROSITE profilePS5086314.522274372IPR003340B3 DNA binding domain
SMARTSM010192.0E-24275372IPR003340B3 DNA binding domain
PfamPF023621.2E-19276365IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.3E-20422526IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.75E-19425526IPR015300DNA-binding pseudobarrel domain
CDDcd100174.80E-15429525No hitNo description
PfamPF023626.9E-18430526IPR003340B3 DNA binding domain
SMARTSM010198.6E-21430527IPR003340B3 DNA binding domain
PROSITE profilePS5086314.128430527IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 527 aa     Download sequence    Send to blast
MANKHFFKPL LPGFQRHLTI PVAFFVKYIK GRDEQKKTAK LRSDASKIIW NVKLDGQRLT  60
DGWKEFALAH DLRIGDIVIF RQERDLAFHV TLLGPSCCEI QYGSCLEEES NLEKKEKKSP  120
NEENEEDSCF VANVAPSSLR YDSLLFPKAF VRENGVVTGS GEIVLMNEKG RSWTLKMKQK  180
PSCGTIYIRG GWINFCHANG LKSGDTVTFK MIQRRGTRVL RLLPKEQKEE ANDVSLSTEP  240
ESDEDSNIRK IQRQRKMKKS PRRDTESSSL DNSCFVASIA PSSLRYDTMY LPIKFMRENG  300
IYTKRGEMIL MNQKGRSWTL DLRRKNWCGT FFIKRGWKIF CRANGLSAGS IVTFKLIKKR  360
GTLLTLRLIP NEGEDEESSE ANKVESLSRD QESDEESSHD EKISQECLRR NEKKRRLRWT  420
ASSAPSKNRF VTLTLTPYNV SASVLRLPRP FTRMNDIDKE TKMTLLDKQG KKWSTKLHLE  480
DDKSKRLRMV GGWKGFLQAN CVKANESIML ELIWEEDTIC VLKFRSK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010472473.10.0PREDICTED: B3 domain-containing protein REM14-like
SwissprotO230760.0REM15_ARATH; Putative B3 domain-containing protein REM15
TrEMBLR0FW440.0R0FW44_9BRAS; Uncharacterized protein (Fragment)
STRINGAT4G00260.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24645.10.0B3 family protein